PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g008310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 530aa    MW: 59007.8 Da    PI: 5.721
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g008310.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-173885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
   Csa20g008310.1 38 KGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding53.65.3e-1791134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
   Csa20g008310.1  91 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 134
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016932.1E-2592529IPR016310Transcription factor, GAMYB
PROSITE profilePS5129413.7313385IPR017930Myb domain
SMARTSM007176.5E-153787IPR001005SANT/Myb domain
SuperFamilySSF466891.76E-2937132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-233992IPR009057Homeodomain-like
CDDcd001671.36E-114085No hitNo description
PfamPF139219.6E-1641101No hitNo description
PROSITE profilePS5129426.31686140IPR017930Myb domain
SMARTSM007172.7E-1790138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2593139IPR009057Homeodomain-like
CDDcd001671.38E-1293134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MSNTSTADSD HNESPATDDN NGSDCSRSRW ERSGLLKKGP WSSAEDDILI DYVNKHGEGN  60
WNAVQKHTGL FRCGKSCRLR WANHLRPNLK KGAFSQEEEQ LIVELHAKMG NRWARMAAHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPE MHLEVLEWSQ EYAKSRLMGE DRRHSDFLQL  180
GSCESDVFFD NLSFVTTDMV PGGSDLSDMT AYKNLANAAS SPRYDNFMTP MVPCSKRFWE  240
SELLYPGCSS TIKQEFPSPE QFQNTSSPQK ISKTCSFSVP CDVDHPLYGN QQHSPVVIPD  300
SHTLTGGIVP SSKPSSYEAV KLELPSFQYS ETTFDQWKKS SSPPHSDLLD PFDSYIHSSP  360
LPTGRQESDC FSNCDTGLLD MLLLEAKIRN STTKNDLYKS CASTIPPADL GEVTVSQTKS  420
EEFDNSLKSF VHSEISTQQN ADGIPPRQRE KKRKPLLDIT RPDVLLASSW LDHGLGIAKE  480
SGSMSDALTV LLGDDIGNEY MHTSVGASSG VGSCSWSNMP PVCQMTELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30361395107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1445453PRQREKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010491156.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLR0H6G30.0R0H6G3_9BRAS; Transcription factor
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33